PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aqcoe5G267600.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Ranunculales; Ranunculaceae; Thalictroideae; Aquilegia
Family MYB
Protein Properties Length: 300aa    MW: 34520.1 Da    PI: 5.9209
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aqcoe5G267600.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.46.7e-182471148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
    Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                       rg+WT +Ed+llv++++ +G g+W++ ar  g++Rt+k+c++rw++yl
  Aqcoe5G267600.1.p 24 RGPWTIDEDLLLVNYIATHGEGRWSSLARSAGLKRTGKSCRLRWLNYL 71
                       89********************************************97 PP

2Myb_DNA-binding51.52.3e-1677120146
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
    Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                        rg+ T eE++ +++++ q+G++ W++Ia++++ gRt++++k++w++
  Aqcoe5G267600.1.p  77 RGNITLEEQLTILQLHSQWGNR-WSKIAQHLP-GRTDNEIKNYWRT 120
                        7999******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129425.1091975IPR017930Myb domain
SuperFamilySSF466897.19E-3121118IPR009057Homeodomain-like
SMARTSM007175.2E-142373IPR001005SANT/Myb domain
PfamPF002494.2E-162471IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.7E-222578IPR009057Homeodomain-like
CDDcd001674.50E-102671No hitNo description
SMARTSM007171.9E-1476124IPR001005SANT/Myb domain
PROSITE profilePS5129418.3676126IPR017930Myb domain
PfamPF002491.1E-1477120IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.4E-2379125IPR009057Homeodomain-like
CDDcd001672.70E-1081120No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009737Biological Processresponse to abscisic acid
GO:0009751Biological Processresponse to salicylic acid
GO:0046686Biological Processresponse to cadmium ion
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 300 aa     Download sequence    Send to blast
MDVNRENYDS SSINREEEDF DIKRGPWTID EDLLLVNYIA THGEGRWSSL ARSAGLKRTG  60
KSCRLRWLNY LRPDVRRGNI TLEEQLTILQ LHSQWGNRWS KIAQHLPGRT DNEIKNYWRT  120
RVQKHAKQLG CEVNSKLFRD TMKYLWMPRL MERIRSTTSC NTSTSTTITN HVNDNLVNIT  180
PRQGSHVSSS RSTNSSSAQV DPSYTSENSS TAVSFDEHQL SPVSDMQEES AVPLQLENNV  240
NINTETSTAY VGYPDCLTSP TGYSYFNQNG LEFEQNNMWL GNEDFWENLW NVENMLFSK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C2e-242111824120MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010270853.11e-102PREDICTED: transcription factor MYB108
SwissprotQ9LDE13e-77MY108_ARATH; Transcription factor MYB108
TrEMBLD7SYH22e-99D7SYH2_VITVI; Putative uncharacterized protein
STRINGVIT_05s0077g00500.t016e-99(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G48000.12e-78myb domain protein 112